Gene MELO3C008010.2.1
| Sequence ID | MELO3C008010.2.1 add to my list | ||
|---|---|---|---|
| Species | Cucumis melo | ||
| Alias | No gene alias | ||
| Length | 300aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 300 amino acids
>MELO3C008010.2.1_CUCME MGEEIKKNDDGEDQKKEDTKQQEKKEPTESAVTPPPPTTTTEDEQKKQDNKKNEEEPPQD IVLKVDMHCEACARKVARALKGFQGVENVTTDSRAGKVVVKGKGADPSKVCERLQKKSGR KVELISPLPKPPEEQPKEEDKQPKEEKKEEVPPPPAVVTVVLNVQMHCEACAQVLRKRIR KFKGVESVETELANNQVIVKGVMDPARLVDHVSKRSRRPASIVVKEEEKKEEEKKEEEKP AGEEKAEEKKETQEEEKEEDDKKFDIKRLEYWPSTKYYTEYAYVPERLFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C008010.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.696 | 8 | 192.6 | 9.7e-49 |
| Ca_32_762.1 | orthology | 0.76 | 8 | - | - |
| Ca_69_1.19 | orthology | 0.76 | 8 | - | - |
| Ca_78_26.1 | orthology | 0.696 | 8 | - | - |
| Ca_9_645.2 | orthology | 0.756 | 7 | - | - |
| Cc09_g00430 | orthology | 0.755 | 8 | 147.5 | 1.2e-35 |
| Cg2g046420.1 | orthology | 0.497 | 4 | 204.5 | 8.7e-53 |
| Cm145580.1 | orthology | 0.714 | 3 | - | - |
| Cm298860.1 | orthology | 0.503 | 3 | - | - |
| Cs2g01750.1 | orthology | 0.497 | 4 | 214.9 | 7e-56 |
| DCAR_002239 | orthology | 0.652 | 8 | 215 | 4.9e-69 |
| DCAR_030843 | orthology | 0.694 | 8 | 187.2 | 1.7e-47 |
| FvH4_3g00420.1 | orthology | 0.511 | 6 | 196.8 | 1.9e-50 |
| HanXRQChr16g0515801 | orthology | 0.795 | 8 | 183.3 | 3.5e-46 |
| Manes.09G082500.1 | orthology | 0.65 | 3 | 196 | 9.28e-62 |
| Manes.S022000.1 | orthology | 0.424 | 3 | 161.4 | 1e-39 |
| Oeu029318.1 | orthology | 0.577 | 7 | 221 | 1.08e-71 |
| Oeu057024.1 | orthology | 0.616 | 7 | 189.9 | 3.6e-48 |
| PGSC0003DMP400023518 | orthology | 0.909 | 10 | - | - |
| PGSC0003DMP400026383 | orthology | 0.674 | 9 | 201.4 | 8.3e-52 |
| Solyc04g015030.2.1 | orthology | 0.681 | 9 | 205.7 | 4.4e-53 |
| Solyc11g012690.1.1 | orthology | 0.958 | 10 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.57 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.507 | 6 | 203.4 | 2.3e-52 |
| capan_pan_p012494 | orthology | 0.811 | 8 | - | - |
| capan_pan_p018045 | orthology | 0.924 | 9 | - | - |
| cicar_pan_p024449 | orthology | 0.527 | 5 | 239 | 1.98e-78 |
| cucsa_pan_p011686 | orthology | 0.0276 | 1 | 326 | 2.95e-112 |
| ipotf_pan_p000797 | orthology | 0.696 | 9 | 216 | 2.9e-69 |
| itb01g10210.t2 | orthology | 0.702 | 9 | 191 | 1.2e-48 |
| maldo_pan_p012376 | orthology | 0.524 | 6 | 247 | 2.54e-81 |
| maldo_pan_p020510 | orthology | 0.533 | 6 | - | - |
| medtr_pan_p010658 | orthology | 0.513 | 5 | 230 | 5.79e-75 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.521 | 6 | 215.7 | 4e-56 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.558 | 6 | - | - |
| soybn_pan_p008938 | orthology | 0.502 | 5 | 248 | 8.8e-82 |
| soybn_pan_p009673 | orthology | 0.534 | 5 | - | - |
| soybn_pan_p024238 | orthology | 0.515 | 5 | - | - |
| thecc_pan_p018912 | orthology | 0.442 | 5 | 223 | 7.9e-72 |
| vitvi_pan_p012828 | orthology | 0.502 | 4 | 243 | 5.18e-80 |