Gene MELO3C015862.2.1
| Sequence ID | MELO3C015862.2.1 add to my list |
|---|---|
| Species | Cucumis melo |
| Alias | No gene alias |
| Length | 171aa |
Length: 171 amino acids
>MELO3C015862.2.1_CUCME MGKETKLWFFQKEPDRDDCSKSASKIEHDSIESDSYDEDDNKQFGWHSQHKCVTETMEMK EATSSDVHSCSYSQSLPPMSSNVHAYPYSRSLLPAKSSNVHAYSYSRSLPRFGYQTGWPY QQSVPGHTFTPHSYHLQPHPQPPTYHYFQNRSPPRDNPMVHYTDYRDNYRF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP251501 | Unannotated cluster |
| 3 | GP123640 | Unannotated cluster |
| 4 | GP138104 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G30473.1 | orthology | 1 | 6 | - | - |
| AT4G23882.1 | orthology | 1 | 5 | - | - |
| Cg7g023400.1 | orthology | 1 | 7 | - | - |
| Cm012520.1 | orthology | 1 | 7 | - | - |
| Cs7g01670.1 | orthology | 1 | 6 | - | - |
| brana_pan_p050558 | orthology | 1 | 7 | - | - |
| braol_pan_p028920 | orthology | 1 | 7 | - | - |
| cucsa_pan_p009937 | orthology | 0.0891 | 1 | 253 | 4.62e-86 |
| maldo_pan_p011650 | orthology | 1 | 2 | 46.2 | 2.76e-06 |
| thecc_pan_p012699 | orthology | 1 | 4 | - | - |