Gene MELO3C019982.2.1
Sequence ID | MELO3C019982.2.1 add to my list | ||
---|---|---|---|
Species | Cucumis melo | ||
Alias | No gene alias | ||
Length | 77aa | ||
Gene Ontology |
![]()
|
Length: 77 amino acids
>MELO3C019982.2.1_CUCME MANVVELKVFLHCDECIKKILKAIKKIQDIETYNVDMEMNKVIVTGNVTNEEVIKVLQKI RKTAVPWQDDELNNITN
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP240412 | Unannotated cluster |
3 | GP342479 | Unannotated cluster |
4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C019982.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Manes.07G136400.1 | orthology | 0.37 | 2 | 117.5 | 4.3e-27 |
cajca.ICPL87119.gnm1.ann1.C.cajan_30554.1 | orthology | 0.519 | 4 | 104 | 4.9e-23 |
cicar_pan_p006875 | orthology | 0.637 | 5 | 106 | 2.58e-32 |
cucsa_pan_p000399 | orthology | 0.0644 | 1 | 147 | 9.12e-49 |
medtr_pan_p020630 | orthology | 0.6 | 5 | - | - |
medtr_pan_p025150 | orthology | 0.657 | 5 | 110 | 6.14e-34 |
phavu.G19833.gnm2.ann1.Phvul.001G247400.1 | orthology | 0.493 | 3 | 115.2 | 1.9e-26 |
phavu.G19833.gnm2.ann1.Phvul.008G219600.1 | orthology | 0.608 | 5 | - | - |
soybn_pan_p002448 | orthology | 0.549 | 5 | - | - |
soybn_pan_p012238 | orthology | 0.718 | 5 | - | - |
soybn_pan_p038357 | orthology | 0.514 | 3 | - | - |
soybn_pan_p043843 | orthology | 0.632 | 5 | 113 | 8.88e-35 |