Gene MELO3C031348.2.1
| Sequence ID | MELO3C031348.2.1 add to my list | ||
|---|---|---|---|
| Species | Cucumis melo | ||
| Alias | No gene alias | ||
| Length | 146aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 146 amino acids
>MELO3C031348.2.1_CUCME MGKLVLSIGKVFSCFINTTDSSSTSCCLYRFEIEDSNNFDQKQPLMAKQTTSTTHDLLGF KDVITHQNKTLRPLQFNPKVVMVRVSMHCNGCARRVEKLISKIQGVESWKVDMERERVVV TGDVFPFEVMECISKVKSVEILESQD
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP366458 | Unannotated cluster |
| 4 | GP502787 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C031348.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_1g05260.1 | orthology | 0.904 | 3 | 112.1 | 3e-25 |
| cucsa_pan_p005932 | orthology | 0.0735 | 1 | 142 | 2.21e-45 |
| maldo_pan_p023210 | orthology | 0.953 | 3 | 110 | 1.23e-31 |
| maldo_pan_p051607 | orthology | 0.96 | 3 | - | - |
| maldo_pan_p051649 | orthology | 1 | 3 | - | - |