Gene Manes.01G044300.1
| Sequence ID | Manes.01G044300.1 add to my list | ||
|---|---|---|---|
| Species | Manihot esculenta | ||
| Alias | No gene alias | ||
| Length | 127aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 127 amino acids
>Manes.01G044300.1_MANES MANMQIVPASKNVQAQYVEMMVPLYSYGCERKVKKTLSHLKGIYSVNVDYNQQKVTVWEI CNKNDVLATMKSKRKEARFWNPEDAIADDQMQESSQPPLNKPSLALMKARSLSLKALRKV FTRSFSL
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP342521 | Unannotated cluster |
| 4 | GP077751 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.01G044300.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| thecc_pan_p005700 | orthology | 0.226 | 1 | 195 | 6.27e-66 |