Gene Manes.02G038800.1
Sequence ID | Manes.02G038800.1 add to my list | ||
---|---|---|---|
Species | Manihot esculenta | ||
Alias | No gene alias | ||
Length | 109aa | ||
Gene Ontology |
![]()
|
Length: 109 amino acids
>Manes.02G038800.1_MANES MVTLANNSLMHFEDLTLPSFQVIVMSGSIGCARCRQRVSQVIAKMTGLREYTVDVKRKQV IVKGDFGNQQKQEDDYSKSEMNKERGNCHPLRLLLGSFVASCFRKQVAD
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP022701 | Unannotated cluster |
3 | GP047979 | Unannotated cluster |
4 | GP468909 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.02G038800.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G35730.1 | orthology | 1 | 5 | - | - |
Cm212920.1 | orthology | 1 | 1 | 93.2 | 1.7e-19 |
brana_pan_p001635 | orthology | 1 | 6 | 77 | 2.14e-19 |
brana_pan_p054319 | orthology | 1 | 6 | - | - |
braol_pan_p040844 | orthology | 1 | 6 | 77 | 1.94e-19 |
braol_pan_p052965 | orthology | 1 | 6 | - | - |
brarr_pan_p008654 | orthology | 1 | 5 | 79.3 | 3.58e-20 |
cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 | orthology | 1 | 6 | 90.5 | 8e-19 |
cicar_pan_p024775 | orthology | 1 | 5 | 80.1 | 5.8e-21 |
cucsa_pan_p023048 | orthology | 1 | 3 | 79.7 | 5.11e-21 |
maize_pan_p044279 | orthology | 1 | 4 | - | - |
medtr_pan_p004416 | orthology | 1 | 5 | 79.3 | 1.64e-20 |
phavu.G19833.gnm2.ann1.Phvul.003G219900.1 | orthology | 1 | 6 | 80.1 | 9.7e-16 |
soybn_pan_p039239 | orthology | 1 | 5 | 85.5 | 6.64e-23 |
soybn_pan_p043513 | orthology | 1 | 5 | - | - |
soybn_pan_p045249 | orthology | 1 | 5 | - | - |