Gene Manes.04G015400.1
| Sequence ID | Manes.04G015400.1 add to my list | ||
|---|---|---|---|
| Species | Manihot esculenta | ||
| Alias | No gene alias | ||
| Length | 360aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 360 amino acids
>Manes.04G015400.1_MANES MGKKKSNSNNQTSEHDHDHNNEGEKKEVVQKKEGDDGGGKEGGKHPPTVILKIEMHCEGC VSKIIKLARGLDGVQSVKADTESSKLTVIGIIDPSQIREILHQKTKKKVELLSPQPKKED SNAKNNKGDNKKSSDKKPDAENKKPKEAPVTSAVIKVAFHCLGCIEKIHRIVSKTKGVHE MTLDKQKETVTVKGTMDVKALTETLKDRLKRPVEIVPPKKEKDGGGGGGDKDGENTSGKK KNKGGGDGQDKAAAGGGGGGGAAAKVEGNKIEYMMQPGFGYGPGPGFGYVGQPQPQPQQP VHVYGSGYMGQAMQPMPVYGNGYMAQPQPVPMYEYGYGQVPGYPVHMKFNDENPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.04G015400.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G28090.1 | orthology | 1 | 6 | 151 | 1.4e-36 |
| Cg8g019570.1 | orthology | 0.632 | 2 | 193 | 7.05e-59 |
| Cm049010.1 | orthology | 0.63 | 3 | - | - |
| Cm049020.1 | orthology | 0.66 | 2 | - | - |
| Cs8g15890.1 | orthology | 0.634 | 3 | - | - |
| Cs8g15900.1 | orthology | 0.687 | 2 | - | - |
| DCAR_015174 | orthology | 1 | 5 | - | - |
| Manes.11G150800.1 | ultra-paralogy | 0.205 | 0 | - | - |
| Manes.11G150900.1 | ultra-paralogy | 0.232 | 0 | - | - |
| brana_pan_p035445 | orthology | 1 | 7 | - | - |
| brana_pan_p036106 | orthology | 1 | 7 | - | - |
| braol_pan_p002645 | orthology | 1 | 7 | - | - |
| braol_pan_p042787 | orthology | 1 | 7 | - | - |
| brarr_pan_p026563 | orthology | 1 | 7 | - | - |
| thecc_pan_p013140 | orthology | 0.853 | 4 | - | - |
| vitvi_pan_p000499 | orthology | 0.869 | 2 | 176 | 1.16e-52 |