Gene Manes.04G096100.1
Sequence ID | Manes.04G096100.1 add to my list | ||
---|---|---|---|
Species | Manihot esculenta | ||
Alias | No gene alias | ||
Length | 255aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 255 amino acids
>Manes.04G096100.1_MANES MSKEADLKKTELKVSVICCDGCKRKVKKVLQSIEGVLKTEIDTLQPKVTVLGNVDPQILI RKLLKAGKQAELWSQGSQNAGKEKKEAETPITKEKEKPKSDCDQAKSSNSSSNSTDKNKE IKNGGDGNDNKSPKKEQKDTTTCSNVNSSSNPEIVKTEHPLPPIPQPSETKFPSMFQDLG NVCSWNQCYYKVEPYTVAVPYYALPSYTVGPLSPSCYGQEFLNQGRPVFQPPFQGPAVRV GDYFSDENTMGCHVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.04G096100.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg2g009290.1 | orthology | 0.59 | 4 | 201.8 | 4.8e-52 |
Cm129350.1 | orthology | 0.592 | 4 | 198.7 | 6.9e-51 |
Cs2g14960.1 | orthology | 0.589 | 3 | 111.7 | 7.1e-25 |
DCAR_021816 | orthology | 0.972 | 4 | 147.9 | 9.8e-36 |
cajca.ICPL87119.gnm1.ann1.C.cajan_40153.1 | orthology | 0.878 | 4 | 148.3 | 7.5e-36 |
soybn_pan_p004695 | orthology | 0.964 | 4 | - | - |
soybn_pan_p009525 | orthology | 0.864 | 4 | 147 | 1.05e-43 |
thecc_pan_p023830 | orthology | 0.829 | 3 | 144 | 9.72e-42 |
vitvi_pan_p003003 | orthology | 0.442 | 1 | 209 | 2.14e-67 |