Gene Manes.05G127500.1
| Sequence ID | Manes.05G127500.1 add to my list | ||
|---|---|---|---|
| Species | Manihot esculenta | ||
| Alias | No gene alias | ||
| Length | 92aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 92 amino acids
>Manes.05G127500.1_MANES MESVEFKVEMVGIHEKRLRKSLSKLKGIEKVEVDANSQKVVVTGYAHRNKILKAIRRGGL KADFWSAQNELLNVYSCTASYGSLRFNNSNFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.05G127500.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.353 | 9 | - | - |
| Ca_3_262.11 | orthology | 0.353 | 9 | - | - |
| Ca_455_136.3 | orthology | 0.353 | 9 | - | - |
| Ca_68_16.11 | orthology | 0.376 | 9 | 128.6 | 5.3e-30 |
| Cc10_g00290 | orthology | 0.376 | 9 | 115.9 | 1.2e-26 |
| Cg3g025710.1 | orthology | 0.163 | 5 | 154.1 | 4.2e-38 |
| Cm122260.1 | orthology | 0.174 | 4 | 156.4 | 1.4e-38 |
| Cs3g27690.1 | orthology | 0.163 | 5 | 154.1 | 4.5e-38 |
| DCAR_023025 | orthology | 0.236 | 6 | 146 | 1.3e-35 |
| HORVU7Hr1G051110.3 | orthology | 0.96 | 11 | - | - |
| MELO3C017056.2.1 | orthology | 0.307 | 3 | 138.3 | 2.1e-33 |
| Manes.18G002200.1 | ultra-paralogy | 0.148 | 0 | - | - |
| Mba08_g25790.1 | orthology | 0.583 | 9 | - | - |
| ORGLA08G0178600.1 | orthology | 0.68 | 10 | - | - |
| Oeu013567.1 | orthology | 0.257 | 7 | - | - |
| Sspon.06G0001840-1A | orthology | 0.888 | 9 | - | - |
| Sspon.06G0001840-2C | orthology | 0.7 | 9 | - | - |
| Sspon.06G0001840-3D | orthology | 0.71 | 9 | - | - |
| XP_010932092.1 | orthology | 0.39 | 8 | - | - |
| XP_017697769.1 | orthology | 0.414 | 8 | - | - |
| XP_019707878.1 | orthology | 0.427 | 9 | - | - |
| bradi_pan_p007471 | orthology | 0.691 | 10 | 110 | 2.6e-33 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.367 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.365 | 5 | 141 | 4.3e-34 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.363 | 4 | - | - |
| capan_pan_p037558 | orthology | 0.363 | 8 | 110 | 1.94e-33 |
| cicar_pan_p012771 | orthology | 0.485 | 6 | 130 | 2.18e-41 |
| cocnu_pan_p024788 | orthology | 0.39 | 8 | - | - |
| cocnu_pan_p029661 | orthology | 0.453 | 9 | - | - |
| cucsa_pan_p017207 | orthology | 0.307 | 3 | 137 | 3.51e-44 |
| maize_pan_p023740 | orthology | 0.682 | 9 | 105 | 3.61e-31 |
| maldo_pan_p020708 | orthology | 0.198 | 3 | 136 | 1.6e-43 |
| medtr_pan_p031498 | orthology | 0.418 | 6 | 134 | 6.39e-43 |
| musac_pan_p036492 | orthology | 0.571 | 9 | - | - |
| orysa_pan_p046260 | orthology | 0.656 | 10 | 104 | 9.04e-31 |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.375 | 4 | 138.7 | 1.9e-33 |
| sorbi_pan_p020199 | orthology | 0.658 | 9 | 106 | 1.03e-31 |
| soybn_pan_p018879 | orthology | 0.418 | 4 | 136 | 1.31e-43 |
| soybn_pan_p037728 | orthology | 0.443 | 5 | - | - |
| soybn_pan_p037999 | orthology | 0.484 | 5 | - | - |
| soybn_pan_p041984 | orthology | 0.453 | 5 | - | - |
| thecc_pan_p004256 | orthology | 0.21 | 2 | 141 | 7.26e-46 |
| tritu_pan_p008810 | orthology | 0.696 | 11 | - | - |
| vitvi_pan_p014910 | orthology | 0.152 | 4 | 154 | 1.52e-50 |
| vitvi_pan_p031077 | orthology | 0.152 | 4 | - | - |