Gene Manes.06G009700.1
Sequence ID | Manes.06G009700.1 add to my list | ||
---|---|---|---|
Species | Manihot esculenta | ||
Alias | No gene alias | ||
Length | 192aa | ||
Gene Ontology |
![]()
|
Length: 192 amino acids
>Manes.06G009700.1_MANES MSTKKSSRKMRGFMCQSTAATAVCKVGDPRSVIIPRRPEKSLKQLLDNSSSSSTTSRLLM KKNRDNGVKYSRLVDSPMKLIPPAATNRNRSLLISSIKKLDINDNNNSQENRPKQPSLAS SDQVFQKVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLETKRVTVMGHVSPVGVLESI SKVKPAEFWPCS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.06G009700.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_23_68.6 | orthology | 0.673 | 4 | 166.4 | 4.8e-41 |
Ca_85_96.3 | orthology | 0.674 | 4 | 166 | 1.9e-52 |
Ca_9_475.1 | orthology | 0.683 | 5 | - | - |
Cc02_g21770 | orthology | 0.674 | 5 | 163.7 | 1e-40 |
Cg3g006140.1 | orthology | 0.622 | 4 | 153.3 | 1.5e-37 |
Cm169730.1 | orthology | 0.618 | 4 | - | - |
Cm169730.2.1 | orthology | 0.618 | 4 | 158.3 | 7.7e-39 |
HanXRQChr11g0336891 | orthology | 0.76 | 3 | 141.4 | 9.8e-34 |
MELO3C018661.2.1 | orthology | 0.85 | 6 | 145.2 | 3.6e-35 |
cajca.ICPL87119.gnm1.ann1.C.cajan_13580.1 | orthology | 1 | 5 | - | - |
cucsa_pan_p000289 | orthology | 0.884 | 6 | 144 | 1.99e-44 |
orange1.1t02697.1 | orthology | 0.622 | 4 | 158.3 | 5e-39 |
thecc_pan_p016597 | orthology | 0.523 | 2 | 183 | 1.07e-59 |