Gene Manes.06G121400.1


Sequence ID Manes.06G121400.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 330aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 330 amino acids

>Manes.06G121400.1_MANES
MGEEEKKPAAEEKNMEEKKTEEAKKPEGDKAEKKEEEKPADKPPAEEKKEEKKAEDSKES
KEESPPPPQEIVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKASKVVVKGEKADPLKV
LERVQKKSHRQVVLISPIPKPPSEEEKKAAEEKEKPKPEEKKEEPPVIIVVLKVYMHCEA
CAMEIKKRIQRMKGVETAEPDLKSSQVTVKGVFDPPKLVEYVYKRTGKHAVIVKQEAEKK
PEEEKGKESKAEKKEEGSDKEKKGGEQEENKENKENEGEAKTEAPPTEETKVVELKKNEY
FHYPPRYAMELYAYPPQIFSDENPNACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.06G121400.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg7g010440.1 orthology 0.249 3 230.3 1.6e-60
Cm018610.1 orthology 0.251 3 230.3 2.7e-60
FvH4_5g08650.1 orthology 0.294 4 260 2e-69
Manes.14G049200.1 ultra-paralogy 0.0952 0 - -
maldo_pan_p003643 orthology 0.312 4 - -
maldo_pan_p029843 orthology 0.314 4 - -
orange1.1t02606.2 orthology 0.255 2 230.3 1.8e-60
thecc_pan_p013659 orthology 0.247 2 - -
vitvi_pan_p029254 orthology 0.308 4 294 8.09e-99