Gene Manes.07G136400.1


Sequence ID Manes.07G136400.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 74aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 74 amino acids

>Manes.07G136400.1_MANES
MTNVVELKVGLHCDECIKKILKAVKKIQDIETYNVDIELNKVIVTGNVTTEEVIRVIQKI
GKTATAWDGDQTNS




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP240412 Unannotated cluster
3 GP342479 Unannotated cluster
4 GP464531 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.07G136400.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C019982.2.1 orthology 0.37 2 118.6 1.4e-27
cajca.ICPL87119.gnm1.ann1.C.cajan_30554.1 orthology 0.326 3 116.7 7.1e-27
cicar_pan_p006875 orthology 0.443 4 114 1.05e-35
cucsa_pan_p000399 orthology 0.338 2 115 5.51e-36
medtr_pan_p020630 orthology 0.406 4 - -
medtr_pan_p025150 orthology 0.463 4 115 1.19e-35
phavu.G19833.gnm2.ann1.Phvul.001G247400.1 orthology 0.299 2 123.2 6.8e-29
phavu.G19833.gnm2.ann1.Phvul.008G219600.1 orthology 0.414 4 - -
soybn_pan_p002448 orthology 0.355 4 - -
soybn_pan_p012238 orthology 0.524 4 - -
soybn_pan_p038357 orthology 0.32 2 120 1.39e-37
soybn_pan_p043843 orthology 0.438 4 - -