Gene Manes.09G066300.1
Sequence ID | Manes.09G066300.1 add to my list | ||
---|---|---|---|
Species | Manihot esculenta | ||
Alias | No gene alias | ||
Length | 231aa | ||
Gene Ontology |
![]()
|
Length: 231 amino acids
>Manes.09G066300.1_MANES MGAEKKPAAAEPAGGGEKKDDAKVISVYKVDMHCEGCAKKIRRASTVVLKIRTHCDGCIS KMKKIILKFKGVNSVTVDGPKDLVTVKGTMDAKEMVPYLKEKLRRNVDVVPPKKEEEKKG GDGEKKEGDGGKKEAAAAASGGGGAKVEVSKMEYYPAPAPTHWFDGMFGHSYAAEPQHGS YPVNHGYPMMTHGYVQQGYVNQGYVMEPAYHHPMHAPQMFSDENPNSCSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.09G066300.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
CgUng002500.1 | orthology | 0.405 | 4 | - | - |
CgUng019980.1 | orthology | 0.405 | 4 | - | - |
Cm060230.1 | orthology | 0.407 | 2 | - | - |
FvH4_6g16410.1 | orthology | 0.694 | 4 | - | - |
MELO3C024466.2.1 | orthology | 0.663 | 4 | - | - |
Manes.08G010600.1 | ultra-paralogy | 0.163 | 0 | - | - |
cucsa_pan_p001888 | orthology | 0.674 | 4 | - | - |
maldo_pan_p018618 | orthology | 0.66 | 4 | - | - |
maldo_pan_p021518 | orthology | 0.673 | 4 | - | - |
orange1.1t00956.1 | orthology | 0.408 | 3 | - | - |