Gene Manes.09G082500.1
| Sequence ID | Manes.09G082500.1 add to my list | ||
|---|---|---|---|
| Species | Manihot esculenta | ||
| Alias | No gene alias | ||
| Length | 268aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 268 amino acids
>Manes.09G082500.1_MANES MGEEKKEEEKKDEVKDEGKKKEEQKEKKVEEPPEIVLKVDMHCEACARKVARALKGFQGV EEVTTDSKARKVVVKGKAADPLKIYERLKKKTRRKVVLISPLPEPPEQNNQDPSPPPKEE KMVEPPPVVTVVLSIRMHCEACAQALQKRVLKIRGVESVETNVATSQVIVKGIVDPTELI SDVYKKTGKQAFIVKGEEKKKEEEKKEEVNKEEEKKEEEKKEEKKDDDEEEKAYTNRNEY WPSKSYLEYACCAPEMFSEDNPNACYVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.09G082500.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.743 | 8 | - | - |
| Ca_32_762.1 | orthology | 0.807 | 8 | - | - |
| Ca_69_1.19 | orthology | 0.807 | 8 | - | - |
| Ca_78_26.1 | orthology | 0.743 | 8 | - | - |
| Ca_9_645.2 | orthology | 0.802 | 7 | - | - |
| Cc09_g00430 | orthology | 0.802 | 8 | - | - |
| Cg2g046420.1 | orthology | 0.512 | 2 | - | - |
| Cm145580.1 | orthology | 0.729 | 1 | - | - |
| Cm298860.1 | orthology | 0.518 | 1 | - | - |
| Cs2g01750.1 | orthology | 0.512 | 2 | 225 | 1.71e-73 |
| DCAR_002239 | orthology | 0.698 | 8 | - | - |
| DCAR_030843 | orthology | 0.741 | 8 | 199 | 5.27e-63 |
| FvH4_3g00420.1 | orthology | 0.558 | 6 | 217 | 1.61e-70 |
| HanXRQChr16g0515801 | orthology | 0.842 | 8 | 160.2 | 2.8e-39 |
| MELO3C008010.2.1 | orthology | 0.65 | 3 | 197 | 4.44e-62 |
| Manes.S022000.1 | ultra-paralogy | 0.347 | 0 | - | - |
| Oeu029318.1 | orthology | 0.624 | 7 | - | - |
| Oeu057024.1 | orthology | 0.662 | 7 | - | - |
| PGSC0003DMP400023518 | orthology | 0.956 | 10 | - | - |
| PGSC0003DMP400026383 | orthology | 0.72 | 9 | 201 | 5.71e-64 |
| Solyc04g015030.2.1 | orthology | 0.728 | 9 | 205 | 1.72e-65 |
| Solyc11g012690.1.1 | orthology | 1 | 10 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.617 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.554 | 6 | - | - |
| capan_pan_p012494 | orthology | 0.857 | 8 | - | - |
| capan_pan_p018045 | orthology | 0.971 | 9 | - | - |
| cicar_pan_p024449 | orthology | 0.574 | 5 | - | - |
| cucsa_pan_p011686 | orthology | 0.639 | 3 | 194 | 4.7e-61 |
| ipotf_pan_p000797 | orthology | 0.742 | 9 | 201 | 3.84e-64 |
| itb01g10210.t2 | orthology | 0.748 | 9 | 202 | 1.46e-64 |
| maldo_pan_p012376 | orthology | 0.571 | 6 | 232 | 6.73e-76 |
| maldo_pan_p020510 | orthology | 0.58 | 6 | - | - |
| medtr_pan_p010658 | orthology | 0.559 | 5 | 225 | 1.83e-73 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.568 | 6 | 232 | 2.26e-76 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.605 | 6 | - | - |
| soybn_pan_p008938 | orthology | 0.548 | 5 | - | - |
| soybn_pan_p009673 | orthology | 0.58 | 5 | - | - |
| soybn_pan_p024238 | orthology | 0.561 | 5 | 225 | 2.04e-73 |
| thecc_pan_p018912 | orthology | 0.489 | 5 | - | - |
| vitvi_pan_p012828 | orthology | 0.549 | 4 | 220 | 1.44e-71 |