Gene Manes.12G139000.1


Sequence ID Manes.12G139000.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 154aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 154 amino acids

>Manes.12G139000.1_MANES
MGVGGTLEYLSYLITSSGHKHKKKKKQLQTVELKVRMDCDGCELKVKNALSSLSGVKKVE
INRKQQKVTVTGYVDSNKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVR
NVETTATTGTVTRYDQDPYISMFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.12G139000.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg1g028830.1 orthology 0.166 5 - -
Cm206550.1 orthology 0.159 5 - -
Cs1g01860.1 orthology 0.165 4 - -
FvH4_1g21640.1 orthology 0.158 2 - -
MELO3C007779.2.1 orthology 0.143 4 - -
Manes.13G090400.1 ultra-paralogy 0.0972 0 - -
cucsa_pan_p001819 orthology 0.156 4 - -
maldo_pan_p008643 orthology 0.167 2 - -