Gene Manes.14G100500.1
| Sequence ID | Manes.14G100500.1 add to my list |
|---|---|
| Species | Manihot esculenta |
| Alias | No gene alias |
| Length | 90aa |
Length: 90 amino acids
>Manes.14G100500.1_MANES MKTCCMVVRINLDCNACCRKARKIILNMKEIETHMIAKQERRIVLCGRFTPADVAIKLRK KMNRRVEILEIQEMGGSDRIEEPRPIISAS
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G25855.1 | orthology | 0.776 | 2 | 120.2 | 6.8e-28 |
| Cg7g014560.1 | orthology | 0.677 | 4 | 114.4 | 3.6e-26 |
| Cm038010.1 | orthology | 0.678 | 5 | 114.4 | 6e-26 |
| Cs7g13150.1 | orthology | 0.678 | 5 | 114.4 | 3.9e-26 |
| FvH4_4g27630.1 | orthology | 0.84 | 3 | - | - |
| Manes.06G070100.1 | ultra-paralogy | 0.205 | 0 | - | - |
| brana_pan_p048851 | orthology | 0.748 | 4 | 115 | 4.93e-35 |
| brana_pan_p052252 | orthology | 0.741 | 2 | - | - |
| brana_pan_p062585 | orthology | 0.759 | 2 | - | - |
| braol_pan_p011410 | orthology | 0.741 | 2 | 116 | 2.89e-35 |
| braol_pan_p038631 | orthology | 0.77 | 3 | - | - |
| braol_pan_p053779 | orthology | 0.741 | 2 | - | - |
| brarr_pan_p017699 | orthology | 0.766 | 4 | 115 | 3.98e-35 |
| brarr_pan_p042391 | orthology | 0.75 | 2 | - | - |
| maldo_pan_p037558 | orthology | 0.746 | 3 | - | - |
| maldo_pan_p044634 | orthology | 0.745 | 3 | - | - |
| maldo_pan_p046030 | orthology | 0.695 | 3 | - | - |
| maldo_pan_p049521 | orthology | 0.745 | 3 | - | - |
| maldo_pan_p049537 | orthology | 0.704 | 3 | 127 | 6.55e-40 |
| maldo_pan_p055366 | orthology | 0.746 | 3 | - | - |