Gene Manes.15G008800.1


Sequence ID Manes.15G008800.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 311aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 311 amino acids

>Manes.15G008800.1_MANES
MAPELEVQKPQVTEIQVRMDCNGCVQKIKKALHGIRGIYDLYIDFPQQKLTVIGWADPEQ
IVKAIRKTRKIATICSHTEPSDQPAAHPTEPPQPPPEGAATPPPNTEAANPSPAALPAEA
SSPAEPPKDPPPPENPPPADKPSSSQVDTETNAKQPAGPAQAPGQKDVGEVHVIYHHPPD
YGYRYSYPSYGGPWNIHPNNHGLPSDPRYPNGHGLPPEPRYPNGHGLPPEPRYPNAHVLP
RESPQPIYVTHSYNTYRPSPYVTEYEYIHSPPRHTIYSRMDHYSEDYHENTRNGNITSIF
SDENPNACRIV




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP047778 Unannotated cluster
4 GP077656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.15G008800.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg9g002000.1 orthology 0.411 2 193.7 1.6e-49
Cm229420.1 orthology 0.413 2 190.7 2.3e-48
Cs9g03680.1 orthology 0.428 1 171 1.2e-42
FvH4_4g18950.1 orthology 0.591 4 189.1 4.1e-48
cajca.ICPL87119.gnm1.ann1.C.cajan_04327.1 orthology 0.866 5 162.5 4.7e-40
cajca.ICPL87119.gnm1.ann1.C.cajan_31773.1 orthology 0.727 6 203 1.46e-64
cicar_pan_p002360 orthology 0.942 6 179 3.93e-55
maldo_pan_p004517 orthology 0.6 4 251 1.23e-81
maldo_pan_p022412 orthology 0.619 4 - -
medtr_pan_p024125 orthology 0.965 6 104 2.39e-26
phavu.G19833.gnm2.ann1.Phvul.003G108900.1 orthology 0.94 6 152.1 5.7e-37
soybn_pan_p005812 orthology 0.863 5 - -
soybn_pan_p009634 orthology 0.897 6 - -
soybn_pan_p012740 orthology 0.697 6 164 3.68e-49
thecc_pan_p016610 orthology 0.468 2 265 1.85e-87
vitvi_pan_p020280 orthology 0.453 4 241 9.8e-79