Gene Manes.15G126400.1


Sequence ID Manes.15G126400.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 150aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 150 amino acids

>Manes.15G126400.1_MANES
MGVLDSLSDYLSDLFTDARKRRKRKPMQTVDIKVKMDCDGCERRVKNSVSNMKGVKSVEV
NRKQSRVTVSGYVEPNKVLKKVRSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKN
VVQAIPSPNAADEKFITMFSDENPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.15G126400.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg2g033960.1 orthology 0.387 4 - -
Cg2g033970.1 orthology 0.256 3 249.2 1.6e-66
Cm053240.1 orthology 0.387 4 - -
Cm053250.1 orthology 0.27 4 248.8 3.4e-66
Cs2g13790.1 orthology 0.263 4 249.2 1.7e-66
Cs2g13800.1 orthology 0.395 3 - -
MELO3C005315.2.1 orthology 0.45 3 - -
MELO3C012307.2.1 orthology 0.39 3 238 3.2e-63
Manes.17G075300.1 ultra-paralogy 0.122 0 - -
cucsa_pan_p007548 orthology 0.444 3 - -
cucsa_pan_p020835 orthology 0.397 3 234 6.32e-81
thecc_pan_p004875 orthology 0.162 2 268 3.06e-94