Gene Manes.17G055500.1


Sequence ID Manes.17G055500.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 149aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 149 amino acids

>Manes.17G055500.1_MANES
MTIIEMRVHMDCAGCETKIKKALQKLDGVDDIDINMAMQKVTVMGWADQKKILKAVRKTG
RRAELWPYPYNPEYYNFNQQYYYQQQQGTQPAEAITYYAPQYSTSSYNYRKHGYSNEDYG
YYQKPPYSVVDEQTSALFSDENPHACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.17G055500.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg7g011400.1 orthology 0.338 2 201.4 3.7e-52
Cm129650.1 orthology 0.362 2 187.6 9.3e-48
FvH4_3g07830.1 orthology 0.713 5 156 1.8e-38
cajca.ICPL87119.gnm1.ann1.C.cajan_31664.1 orthology 0.476 4 177.9 5.2e-45
cicar_pan_p021456 orthology 0.594 4 168 4.83e-55
maldo_pan_p003465 orthology 0.772 5 - -
maldo_pan_p053909 orthology 0.733 5 180 9.89e-59
soybn_pan_p018217 orthology 0.438 3 193 1.66e-64
thecc_pan_p000996 orthology 0.623 4 188 1.62e-62