Gene Manes.S022000.1
| Sequence ID | Manes.S022000.1 add to my list | ||
|---|---|---|---|
| Species | Manihot esculenta | ||
| Alias | V9M4U8 | ||
| Length | 205aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 205 amino acids
>Manes.S022000.1_MANES GVEEVTTDIKASKVVVKGKAADPLKVSERLQKKSGRKVELISPLPKPPEENKQENPEPPK EEKKDEPPAVITVVLSVRMHCEACAQVLQKRVRKIQGVESVETDLVNSQVIVKGVVDPVK LVDDVYKKTKKQASIVKDEEKKEEEKKEEEKKEEGEKKDGEEEKEEDDKKSDIKRNEYWP SKSYLEYVYDPEIFSDENPNACFVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP342504 | Unannotated cluster |
| 4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.S022000.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.516 | 8 | 169.1 | 7.9e-42 |
| Ca_32_762.1 | orthology | 0.581 | 8 | - | - |
| Ca_69_1.19 | orthology | 0.581 | 8 | - | - |
| Ca_78_26.1 | orthology | 0.516 | 8 | - | - |
| Ca_9_645.2 | orthology | 0.576 | 7 | 198 | 4.7e-64 |
| Cc09_g00430 | orthology | 0.575 | 8 | 169.1 | 2.7e-42 |
| Cg2g046420.1 | orthology | 0.286 | 2 | 189.5 | 2e-48 |
| Cm145580.1 | orthology | 0.502 | 1 | - | - |
| Cm298860.1 | orthology | 0.291 | 1 | 128.3 | 9.2e-30 |
| Cs2g01750.1 | orthology | 0.286 | 2 | 189.5 | 2.2e-48 |
| DCAR_002239 | orthology | 0.472 | 8 | 167.5 | 9.6e-42 |
| DCAR_030843 | orthology | 0.514 | 8 | - | - |
| FvH4_3g00420.1 | orthology | 0.332 | 6 | 159.5 | 2.3e-39 |
| HanXRQChr16g0515801 | orthology | 0.615 | 8 | - | - |
| MELO3C008010.2.1 | orthology | 0.424 | 3 | 155.2 | 3.8e-38 |
| Manes.09G082500.1 | ultra-paralogy | 0.347 | 0 | - | - |
| Oeu029318.1 | orthology | 0.397 | 7 | - | - |
| Oeu057024.1 | orthology | 0.436 | 7 | 189.9 | 2.5e-48 |
| PGSC0003DMP400023518 | orthology | 0.729 | 10 | - | - |
| PGSC0003DMP400026383 | orthology | 0.494 | 9 | - | - |
| Solyc04g015030.2.1 | orthology | 0.501 | 9 | - | - |
| Solyc11g012690.1.1 | orthology | 0.778 | 10 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.39 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.327 | 6 | 172.2 | 3.9e-43 |
| capan_pan_p012494 | orthology | 0.631 | 8 | - | - |
| capan_pan_p018045 | orthology | 0.744 | 9 | - | - |
| cicar_pan_p024449 | orthology | 0.347 | 5 | 207 | 1.21e-67 |
| cucsa_pan_p011686 | orthology | 0.412 | 3 | - | - |
| ipotf_pan_p000797 | orthology | 0.516 | 9 | - | - |
| itb01g10210.t2 | orthology | 0.522 | 9 | 161 | 9.3e-40 |
| maldo_pan_p012376 | orthology | 0.344 | 6 | - | - |
| maldo_pan_p020510 | orthology | 0.353 | 6 | - | - |
| medtr_pan_p010658 | orthology | 0.333 | 5 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.341 | 6 | 201.4 | 5.4e-52 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.378 | 6 | - | - |
| soybn_pan_p008938 | orthology | 0.322 | 5 | 214 | 6.2e-70 |
| soybn_pan_p009673 | orthology | 0.354 | 5 | - | - |
| soybn_pan_p024238 | orthology | 0.335 | 5 | - | - |
| thecc_pan_p018912 | orthology | 0.262 | 5 | 206 | 6.25e-67 |
| vitvi_pan_p012828 | orthology | 0.322 | 4 | - | - |