Gene Mba01_g01930.1


Sequence ID Mba01_g01930.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 203aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 203 amino acids

>Mba01_g01930.1_MUSBA
MKTGVEDVKTDCKSRTVVIKGKAADPANICERIQKKTGKKVELISPLPKPPEEEEKKEEA
EAPPEETKEEPKPITVILKVRMHCERCAQVLQKRIKKMDGVESVATDLASSQVIVTGFID
PVKLAENVHRRTRKQASIVPEEEKKEEEGEKKDDNGDEEKKQEEEDVKDDISKYEYWPSR
DYVEYAYTPQTFSDENPNACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP464372 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba01_g01930.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr07989 orthology 0.525 3 165.6 2.9e-41
ORGLA10G0044600.1 orthology 0.615 4 136 2.9e-32
XP_008785647.1 orthology 0.318 4 192.6 4e-49
XP_008790335.1 orthology 0.327 4 - -
XP_010939247.1 orthology 0.324 5 197.2 1.7e-50
cocnu_pan_p027064 orthology 0.297 5 180 2.01e-58
cocnu_pan_p028794 orthology 0.349 4 - -
musac_pan_p010117 orthology 0.0392 1 288 1.88e-99
orysa_pan_p012537 orthology 0.615 4 155 8.07e-47