Gene Mba01_g27610.1
| Sequence ID | Mba01_g27610.1 add to my list |
|---|---|
| Species | Musa balbisiana |
| Alias | No gene alias |
| Length | 93aa |
Length: 93 amino acids
>Mba01_g27610.1_MUSBA MGKLDPWKLRDRVEAKTHKKVDLVSPANFPKKGADANDPSSSSAKMPAAVKKPDDKKPQD KASRLFLHYIIVLLLDSINPSFLPFFHENLSLR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP593242 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_008789540.1 | orthology | 0.892 | 2 | - | - |
| XP_010935709.1 | orthology | 0.949 | 3 | - | - |
| XP_010940635.1 | orthology | 1 | 2 | - | - |
| XP_010940636.1 | orthology | 1 | 2 | - | - |
| XP_010940637.1 | orthology | 1 | 2 | - | - |
| XP_010940638.1 | orthology | 1 | 2 | - | - |
| XP_010940639.1 | orthology | 1 | 3 | - | - |
| XP_010940640.1 | orthology | 1 | 3 | - | - |
| XP_017698238.1 | orthology | 0.892 | 2 | - | - |
| XP_019710924.1 | orthology | 1 | 2 | - | - |
| XP_026663426.1 | orthology | 0.857 | 2 | - | - |
| cocnu_pan_p000446 | orthology | 1 | 3 | - | - |
| cocnu_pan_p014481 | orthology | 0.974 | 3 | - | - |
| cocnu_pan_p016505 | orthology | 1 | 2 | - | - |
| musac_pan_p011710 | orthology | 0.316 | 1 | - | - |