Gene Mba02_g01150.1
| Sequence ID | Mba02_g01150.1 add to my list | ||
|---|---|---|---|
| Species | Musa balbisiana | ||
| Alias | No gene alias | ||
| Length | 272aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 272 amino acids
>Mba02_g01150.1_MUSBA MVPELEVIKQVYERMMEIDGKGIMNMLSNWHLRSRVSKLQKARVLEFQVRMDCNGCVQRI KRAMHGIDGVYNVNIDLASQKLTVVGTADPDKIVKAIKKTRKIATICSHTENTGPEQPPP PTEAAPSSDPPASDAANQPPAEPPKDDAPSQDNALVQVEKPSPEAKDAVPVHLKDVGEIP MVVHHYPYDCIQKGQWNYYYPQRHGAIPCHPPYHVIQSYNNYRSAPYPPQDIRYAALGLY DEDGYWHHGRGGDRNQITSVFSEENPSACRIV
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba02_g01150.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_008795807.1 | orthology | 0.453 | 3 | 209.5 | 4.3e-54 |
| XP_010922268.1 | orthology | 0.476 | 4 | 203.4 | 3.3e-52 |
| cocnu_pan_p004474 | orthology | 0.484 | 4 | 243 | 1.74e-80 |
| musac_pan_p043456 | orthology | 0.0417 | 1 | 441 | 6.17e-159 |