Gene Mba02_g09520.1


Sequence ID Mba02_g09520.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 151aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 151 amino acids

>Mba02_g09520.1_MUSBA
MGALDHLSDMCSVTETKRTLQIRKRRPLQTVDLKVKMDCEGCERRVKHAVSSIRGVTNVN
VSRKQSRVTVTGHIEAKQVLERIKSTGKRAELWPYVPYNLVAYPYVAGAYDKKAPSGFVR
NAAQAVLNPNAPEEQYMSLFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba02_g09520.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr15258 orthology 0.505 3 - -
XP_008811964.1 orthology 0.335 4 - -
XP_010916340.1 orthology 0.357 5 - -
cocnu_pan_p017926 orthology 0.378 5 - -
musac_pan_p028185 orthology 0.0205 1 301 6.66e-107