Gene Mba02_g11510.1
Sequence ID | Mba02_g11510.1 add to my list | ||
---|---|---|---|
Species | Musa balbisiana | ||
Alias | No gene alias | ||
Length | 117aa | ||
Gene Ontology |
![]()
|
Length: 117 amino acids
>Mba02_g11510.1_MUSBA MLLSGSLTDAGVDTVEIDMDKQKVTVTGYVEERKVIKAVRRTGRKAELWPFPYDAEYYPF ALQYLEDSTFSSTHNYYRHGYTSTVHGYFPDAAYSMIVDDHAFALFNDDNVHACVIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba02_g11510.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr00501 | orthology | 0.371 | 3 | 190.3 | 6.4e-49 |
HORVU6Hr1G066220.1 | orthology | 0.832 | 4 | 162.2 | 2.4e-40 |
Sspon.04G0006170-1A | orthology | 0.981 | 4 | - | - |
Sspon.04G0023540-1B | orthology | 1 | 4 | 152.5 | 5.1e-37 |
XP_008783549.1 | orthology | 0.322 | 5 | 188.3 | 4.4e-48 |
XP_010934033.1 | orthology | 0.263 | 5 | 191 | 7.2e-49 |
cocnu_pan_p034578 | orthology | 0.301 | 4 | 184 | 9.92e-62 |
maize_pan_p014734 | orthology | 0.967 | 4 | 139 | 6.94e-44 |
musac_pan_p001552 | orthology | 0.0684 | 1 | 221 | 5.47e-76 |
orysa_pan_p046445 | orthology | 0.614 | 3 | 159 | 2.48e-51 |
sorbi_pan_p005993 | orthology | 0.688 | 3 | 149 | 3.5e-47 |
tritu_pan_p005371 | orthology | 0.628 | 4 | - | - |
tritu_pan_p026136 | orthology | 0.633 | 4 | 152 | 2.38e-48 |