Gene Mba03_g01140.1
| Sequence ID | Mba03_g01140.1 add to my list | ||
|---|---|---|---|
| Species | Musa balbisiana | ||
| Alias | No gene alias | ||
| Length | 399aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 399 amino acids
>Mba03_g01140.1_MUSBA MSGTRQRDDPVQAMPTTLNSAEVRQQEESAVEMGKGEDFELLKIQTHILKVNIHCDGCKL KVKKLLHRTEGVFSVSIDVEQQKVTVSGNVDSETLIRKLIKARKHAELWTQKINQTRQLN QQKQQQKLVANPMKDANKNNKEQDKQSLMRGLKAFKNQHNKLSPSSSDEEDFDDDDDDNE DVDYDEEEGDADMQNLDSKMKQTNFMRQVNNAPTNAKQNGNDNGKAGANAKIGCNRKGGE NANQNHIKSPNESQQKGTNAAANNRVVNGNPKVQGNNGVMGLGPPGLGGNNGCLPGNAFK GYTGHPPQCGGQYQSPVTVNMQGYQTHPSVNNLRGHNMVVHESRYMQPQMMHLRTSQISP YAGYYNCYSSPYYLSNQVDNGYYGTHLFSDENTNACVIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba03_g01140.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr15259 | orthology | 0.78 | 4 | 159 | 9.74e-45 |
| HORVU3Hr1G004420.1 | orthology | 0.881 | 4 | 95.9 | 1.27e-21 |
| ORGLA01G0014900.1 | orthology | 0.87 | 4 | 149 | 1.02e-40 |
| Sspon.03G0019370-1A | orthology | 0.986 | 5 | - | - |
| Sspon.03G0019370-2C | orthology | 0.946 | 5 | - | - |
| Sspon.03G0019370-3D | orthology | 0.931 | 5 | - | - |
| XP_008806263.1 | orthology | 0.508 | 2 | 293 | 1.6e-96 |
| XP_010916342.1 | orthology | 0.547 | 4 | 250.4 | 3.4e-66 |
| XP_010926063.1 | orthology | 0.532 | 3 | - | - |
| XP_019707202.1 | orthology | 0.532 | 3 | - | - |
| XP_026656869.1 | orthology | 0.555 | 3 | 201.1 | 2.2e-51 |
| bradi_pan_p041682 | orthology | 0.814 | 3 | 153 | 4.01e-42 |
| cocnu_pan_p016981 | orthology | 0.544 | 3 | - | - |
| cocnu_pan_p021838 | orthology | 0.525 | 4 | - | - |
| cocnu_pan_p035969 | orthology | 0.525 | 4 | - | - |
| maize_pan_p016355 | orthology | 1 | 5 | - | - |
| maize_pan_p016830 | orthology | 0.985 | 5 | 121 | 2.08e-30 |
| musac_pan_p032325 | orthology | 0.0263 | 1 | 604 | 4.48e-219 |
| orysa_pan_p014393 | orthology | 0.87 | 4 | 150 | 5.75e-41 |
| sorbi_pan_p026568 | orthology | 0.925 | 4 | - | - |
| tritu_pan_p033683 | orthology | 0.86 | 4 | - | - |
| tritu_pan_p038784 | orthology | 0.85 | 4 | 171 | 5.22e-49 |
| tritu_pan_p048092 | orthology | 0.861 | 4 | - | - |