Gene Mba03_g16740.1
| Sequence ID | Mba03_g16740.1 add to my list |
|---|---|
| Species | Musa balbisiana |
| Alias | No gene alias |
| Length | 107aa |
Length: 107 amino acids
>Mba03_g16740.1_MUSBA MGSQKVTVTGYVDQKKVLKAVRRTGRRAVLWPYQYSAEQHHTFSHQYHQHHPALAQAGVS GPSSSYNYYKHGYDDSRMHGYYQQSAMTGNRTGDIFSDENPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HORVU3Hr1G072940.2 | orthology | 0.527 | 4 | - | - |
| ORGLA01G0256400.1 | orthology | 0.436 | 3 | - | - |
| Sspon.03G0031090-1B | orthology | 0.499 | 3 | - | - |
| Sspon.03G0031090-2C | orthology | 0.499 | 3 | - | - |
| XP_008813766.1 | orthology | 0.227 | 4 | - | - |
| XP_010920018.1 | orthology | 0.239 | 5 | - | - |
| bradi_pan_p002062 | orthology | 0.569 | 3 | - | - |
| cocnu_pan_p020915 | orthology | 0.248 | 5 | 145 | 1.15e-46 |
| musac_pan_p001588 | orthology | 0.0214 | 1 | 219 | 1.21e-75 |
| orysa_pan_p003551 | orthology | 0.429 | 3 | - | - |
| sorbi_pan_p007128 | orthology | 0.498 | 3 | - | - |
| tritu_pan_p029517 | orthology | 0.483 | 4 | - | - |