Gene Mba04_g24060.1


Sequence ID Mba04_g24060.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 122aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 122 amino acids

>Mba04_g24060.1_MUSBA
MANLQIVPAGKNVEAQYVEMKVPLYSYGCEKKVKKALSHRRGIHSVHVDYKLQKVTVWGI
CNKDDVLATIRKKRREARFWEQVEPEAAEGKVEDEMAVAKASRLAAAKGHRLRLSWKKLF
PL




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP077751 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba04_g24060.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU2Hr1G093870.1 orthology 0.735 6 144.8 4.1e-35
Sspon.05G0023740-1B orthology 0.515 4 - -
Sspon.05G0023740-1P orthology 0.515 5 - -
Sspon.05G0023740-2D orthology 0.515 5 158.7 7.4e-39
XP_008808278.1 orthology 0.41 3 186.4 1.7e-47
XP_010919018.1 orthology 0.417 4 - -
XP_010934032.1 orthology 0.376 3 182.2 3.5e-46
bradi_pan_p042306 orthology 0.763 5 145 4.63e-46
cocnu_pan_p020678 orthology 0.392 3 - -
cocnu_pan_p024529 orthology 0.465 4 181 4.76e-60
maize_pan_p011588 orthology 0.601 3 141 1.78e-44
musac_pan_p009117 orthology 0.0165 1 241 3.33e-84
orysa_pan_p048607 orthology 0.693 4 154 1.71e-49
orysa_pan_p051674 orthology 1 4 - -
sorbi_pan_p001968 orthology 0.531 4 156 1.55e-50
tritu_pan_p012747 orthology 0.736 6 145 6.29e-46
tritu_pan_p017403 orthology 0.745 6 - -
tritu_pan_p047012 orthology 0.728 6 - -