Gene Mba05_g07700.1
Sequence ID | Mba05_g07700.1 add to my list | ||
---|---|---|---|
Species | Musa balbisiana | ||
Alias | No gene alias | ||
Length | 320aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 320 amino acids
>Mba05_g07700.1_MUSBA MNQCVITDSTMGEAKQEAEAKQEEKKEEKAEEKKEVPKTVTSFPPSSCRWTCTVLDVRRR SRNPYSNAEIPTSGVESVEMGMTQNQVTVKGIVDPRTLCSMIQKRTMRKAGVLSPLPPAE GDYKPEAVPSQGACAEQLKTKRLKMRGVQAAVTDLRAGKVTVTGTMNGEKLVEYIRRRTG KVASIVPQPPKEEQKEEAEKKPEETPAEGKKEEKQTEEKKEEVKSPQPQDSAGSNKDGDG KEEKGGGEEQKEEGGGEATAAGVSEADVIKKMIYWNGSFIGEDEMARRMLHWMPVYVIQQ PPPPPPQLCSDENPNACCVS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba05_g07700.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
XP_008783550.1 | orthology | 0.413 | 3 | - | - |
XP_008808288.1 | orthology | 0.449 | 2 | - | - |
XP_008808289.1 | orthology | 0.449 | 2 | - | - |
XP_010911103.1 | orthology | 0.596 | 3 | - | - |
XP_010919013.1 | orthology | 0.48 | 3 | - | - |
XP_010934034.1 | orthology | 0.434 | 4 | - | - |
cocnu_pan_p018242 | orthology | 0.502 | 3 | - | - |
cocnu_pan_p019921 | orthology | 0.44 | 4 | - | - |
musac_pan_p044150 | orthology | 0.242 | 1 | - | - |