Gene Mba05_g22300.1
Sequence ID | Mba05_g22300.1 add to my list | ||
---|---|---|---|
Species | Musa balbisiana | ||
Alias | No gene alias | ||
Length | 339aa | ||
Gene Ontology |
![]()
|
Length: 339 amino acids
>Mba05_g22300.1_MUSBA MGEAQQEEAKADPKPKVDDKKEDKKEKQEEIKKEEVDEKKAAEAKPSPPFPIVLSLDLHC VGCARKIEKLILKCRGVEGVEVDMVQNQVTVKGVVDPQVVCSRIQKRTLRRAKVLAPLPP AEGDYKPDAVPPQVSEMTTVELLVNMHCEACAQQLRRKILKMRGVQTVETDFGAGKITVT GTMKAETLVEHIHRRTLKFASVVSQPPKEEEKKQEDEKKAEEKPAEEKKEESREKKEEQK ATSEEEKTEGSKEGGDIGGGKEEKGGGEEANKEEDGGSKSIISEEDMMKRMMMYWNGGII GGEDMAKRTVHWVPVYVIQQPLPPPQIFSDENPNACCIL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba05_g22300.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
XP_008783550.1 | orthology | 0.362 | 3 | - | - |
XP_008808288.1 | orthology | 0.398 | 2 | - | - |
XP_008808289.1 | orthology | 0.398 | 2 | 244.2 | 2e-64 |
XP_010911103.1 | orthology | 0.545 | 3 | - | - |
XP_010919013.1 | orthology | 0.429 | 3 | - | - |
XP_010934034.1 | orthology | 0.383 | 4 | 263 | 5.5e-86 |
cocnu_pan_p018242 | orthology | 0.451 | 3 | - | - |
cocnu_pan_p019921 | orthology | 0.39 | 4 | 258 | 1.19e-84 |
musac_pan_p028148 | orthology | 0.02 | 1 | 431 | 3.98e-152 |