Gene Mba06_g01230.1
| Sequence ID | Mba06_g01230.1 add to my list |
|---|---|
| Species | Musa balbisiana |
| Alias | No gene alias |
| Length | 233aa |
Length: 233 amino acids
>Mba06_g01230.1_MUSBA MEVAMELVMGGKGCREGGREATAYPAGKMSTCTGRDVRGRCGGAEEVVADSRMHRVAVKG RNAAEDPMRWWRESRRRTEGKWNCSAPCRHRRSRRSEVRRSTKRGGEGAASDPCCAQSLP ALRRLHPKIKKRILRMKARKVDLFGGNGGADGGARHEELGGDCEGRVRLGEPGGVRPQAA VVKQETEEKTRPRRRSHGRRRGRANEEDKKGSGEEAEKEKKAEGEKKEAFRSC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP370991 | Unannotated cluster |
| 4 | GP514151 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| musac_pan_p038275 | orthology | 0.455 | 1 | - | - |
| orysa_pan_p035721 | orthology | 1 | 2 | - | - |