Gene Mba06_g07140.1
Sequence ID | Mba06_g07140.1 add to my list | ||
---|---|---|---|
Species | Musa balbisiana | ||
Alias | No gene alias | ||
Length | 341aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 341 amino acids
>Mba06_g07140.1_MUSBA MGEEEKKAEQGKKEEPKAKEEKKEEGKGEDGKKGGGGGGEGEKKEGGGEEKKADEPPPPP PEEIVMRVYMHCEGCARKVKRSLKGFEGVEDVKTDCRTHKVVVKGKKAAEDPMKVVERVQ KKAGRKVELLTPLPPPKPEKKEEEKKEEEKPKVEEKKEEPQVIAVVLKVHMHCEACAQEI KKRILKMKGVQAAEPDLKASQVTVKGVFDPQKLGEYVYKRTGKQAVVAKQEPAEKKAEDD KGGGGDAAKDEKKADEAGGGNAEGEKKEEKDGGGGQGGGDEKDKKEGGGAAEDGAAPATK VVELVRNEFYQYYPRYPGGYVGYAYPPQIFSDENPNACAVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba06_g07140.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
XP_008798969.1 | orthology | 0.213 | 3 | 229.2 | 6.5e-60 |
XP_008807425.1 | orthology | 0.228 | 2 | - | - |
XP_010905511.1 | orthology | 0.236 | 3 | - | - |
XP_010913005.1 | orthology | 0.226 | 4 | 218 | 1.6e-56 |
XP_019703519.1 | orthology | 0.226 | 4 | 261 | 2.15e-85 |
cocnu_pan_p026834 | orthology | 0.273 | 3 | - | - |
cocnu_pan_p032228 | orthology | 0.235 | 4 | - | - |
cocnu_pan_p033823 | orthology | 0.213 | 4 | 268 | 2.11e-88 |
musac_pan_p006095 | orthology | 0.0081 | 1 | 402 | 5.11e-141 |