Gene Mba06_g07140.1


Sequence ID Mba06_g07140.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 341aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 341 amino acids

>Mba06_g07140.1_MUSBA
MGEEEKKAEQGKKEEPKAKEEKKEEGKGEDGKKGGGGGGEGEKKEGGGEEKKADEPPPPP
PEEIVMRVYMHCEGCARKVKRSLKGFEGVEDVKTDCRTHKVVVKGKKAAEDPMKVVERVQ
KKAGRKVELLTPLPPPKPEKKEEEKKEEEKPKVEEKKEEPQVIAVVLKVHMHCEACAQEI
KKRILKMKGVQAAEPDLKASQVTVKGVFDPQKLGEYVYKRTGKQAVVAKQEPAEKKAEDD
KGGGGDAAKDEKKADEAGGGNAEGEKKEEKDGGGGQGGGDEKDKKEGGGAAEDGAAPATK
VVELVRNEFYQYYPRYPGGYVGYAYPPQIFSDENPNACAVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba06_g07140.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
XP_008798969.1 orthology 0.213 3 229.2 6.5e-60
XP_008807425.1 orthology 0.228 2 - -
XP_010905511.1 orthology 0.236 3 - -
XP_010913005.1 orthology 0.226 4 218 1.6e-56
XP_019703519.1 orthology 0.226 4 261 2.15e-85
cocnu_pan_p026834 orthology 0.273 3 - -
cocnu_pan_p032228 orthology 0.235 4 - -
cocnu_pan_p033823 orthology 0.213 4 268 2.11e-88
musac_pan_p006095 orthology 0.0081 1 402 5.11e-141