Gene Mba06_g17710.1
Sequence ID | Mba06_g17710.1 add to my list | ||
---|---|---|---|
Species | Musa balbisiana | ||
Alias | No gene alias | ||
Length | 100aa | ||
Gene Ontology |
![]()
|
Length: 100 amino acids
>Mba06_g17710.1_MUSBA MAETVVLKVGMSCQGCVGAVKRVLTKMEGVESFDVDLKEQKVTVKGNVKPEDVFQTVSKT GKKTSFWEAEPEAKEAALAAPTEEDAPSAPDAVADVTTAA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba06_g17710.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU7Hr1G100230.1 | orthology | 0.676 | 3 | 122.1 | 2.3e-28 |
Sspon.04G0025740-1B | orthology | 0.537 | 4 | - | - |
Sspon.04G0025740-2C | orthology | 0.537 | 4 | - | - |
Sspon.04G0025740-3D | orthology | 0.537 | 4 | - | - |
bradi_pan_p000852 | orthology | 0.571 | 2 | 128 | 3.94e-40 |
maize_pan_p017319 | orthology | 0.506 | 2 | 122 | 9.34e-38 |
musac_pan_p007187 | orthology | 0.0245 | 1 | 154 | 3.23e-50 |
orysa_pan_p027340 | orthology | 0.447 | 2 | 127 | 4.34e-39 |
sorbi_pan_p000050 | orthology | 0.531 | 3 | - | - |
tritu_pan_p009809 | orthology | 0.722 | 2 | 122 | 1.2e-37 |
tritu_pan_p034911 | orthology | 0.653 | 3 | - | - |
tritu_pan_p050141 | orthology | 0.673 | 2 | - | - |