Gene Mba07_g12280.1


Sequence ID Mba07_g12280.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 147aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 147 amino acids

>Mba07_g12280.1_MUSBA
MTIVEMCVHMDCSGCESKIRKALLKLEGVHDVEIDMARQKVTVTGWVDQKKALKAVRKTG
RRAVLWPYPMNEEDATYSQAYYHLQRPAPAHHLIFNAAPKSKYNYRKHGYDDSSMHGYYQ
RPPHSHIIDEKARMMFSDDNPNACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba07_g12280.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
XP_008812071.1 orthology 0.306 3 243.8 1.1e-64
XP_010915521.1 orthology 0.321 4 - -
XP_010925640.1 orthology 0.324 3 - -
cocnu_pan_p022210 orthology 0.337 3 - -
cocnu_pan_p023665 orthology 0.308 4 - -
musac_pan_p015597 orthology 0.0322 1 300 9.94e-107