Gene Mba09_g23440.1
| Sequence ID | Mba09_g23440.1 add to my list | ||
|---|---|---|---|
| Species | Musa balbisiana | ||
| Alias | No gene alias | ||
| Length | 82aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 82 amino acids
>Mba09_g23440.1_MUSBA MTMRINIDCNGCYRKINRILLQTQGLENHWIERKQCMVSVSGVFVPQDVAIRLRKKTNRR VEILDIKEVDISNDGSITQKPP
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba09_g23440.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_010909619.1 | orthology | 0.412 | 4 | 127.1 | 9e-30 |
| XP_017700247.1 | orthology | 0.391 | 3 | 128.3 | 3.8e-30 |
| cocnu_pan_p015513 | orthology | 0.422 | 4 | 126 | 9.29e-40 |
| musac_pan_p014766 | orthology | 0.0706 | 1 | 162 | 5.96e-54 |