Gene Mba11_g02440.1


Sequence ID Mba11_g02440.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 174aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 174 amino acids

>Mba11_g02440.1_MUSBA
MAASLATALHSFLSTIYPFRYQRSHPKSLMREFWVYSLDSVSLMTVELKVRMCCTGCERV
VKQALLKLRGVDSVEVDLELEKVTVTGYVDRNKVLKEVRRSGKKAEFWPNPDLPLHFTTA
KDYFHDEESFRDSYNYWKHGYNGDKHGRLPVTHRGEDAVSNMFNDDDVNACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba11_g02440.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
XP_008783756.1 orthology 0.615 3 - -
XP_008808277.1 orthology 0.372 3 - -
XP_010919019.1 orthology 0.392 4 - -
XP_019709212.1 orthology 0.441 4 - -
cocnu_pan_p010737 orthology 0.388 4 - -
cocnu_pan_p018453 orthology 0.461 4 - -
musac_pan_p008518 orthology 0.0838 1 318 1.59e-112