Gene ORGLA03G0040300.1


Sequence ID ORGLA03G0040300.1  add to my list
Species Oryza glaberrima
Alias No gene alias
Length 155aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 155 amino acids

>ORGLA03G0040300.1_ORYGL
MGVDDIIAELRVLPAKILPKKKPKQFQKVEVKVRMDCEGCERKVRKAVEEMKGVSSVEVD
AKQNKVTVTGYVEQEEVVGRLRRRAGKKAEPWPYVPYDVVPHPYAPGAYDKKAPPGYVRN
ALADPDAAPLARATEEEEKLASAFSDENPNSCAVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for ORGLA03G0040300.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
XP_008807137.1 orthology 0.556 3 - -
XP_008809430.1 orthology 0.505 3 - -
XP_010920102.1 orthology 0.517 4 - -
XP_010933357.1 orthology 0.507 4 - -
cocnu_pan_p018212 orthology 0.503 4 - -
cocnu_pan_p019869 orthology 0.485 4 - -
cocnu_pan_p033502 orthology 0.515 4 - -
orysa_pan_p027349 orthology 0 1 306 1.16e-108