Gene ORGLA08G0178600.1
Sequence ID | ORGLA08G0178600.1 add to my list | ||
---|---|---|---|
Species | Oryza glaberrima | ||
Alias | No gene alias | ||
Length | 91aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 91 amino acids
>ORGLA08G0178600.1_ORYGL VQSTELKVEMVALHEKRVRKCLSKVKGVERVEVEGSLQKVVVTGYANRSKILKALRRVGL RAEPWSPRNELLSAYAAGSLMAANNYYHTFF
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ORGLA08G0178600.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_12_32.9 | orthology | 0.748 | 10 | - | - |
Ca_3_262.11 | orthology | 0.748 | 10 | - | - |
Ca_455_136.3 | orthology | 0.748 | 10 | - | - |
Ca_68_16.11 | orthology | 0.771 | 10 | 99.8 | 2.6e-21 |
Cc10_g00290 | orthology | 0.771 | 10 | 90.9 | 4.1e-19 |
Cg3g025710.1 | orthology | 0.642 | 12 | 109 | 1.5e-24 |
Cm122260.1 | orthology | 0.653 | 11 | 109 | 2.5e-24 |
Cs3g27690.1 | orthology | 0.642 | 12 | 109 | 1.6e-24 |
DCAR_023025 | orthology | 0.631 | 7 | 100.1 | 8.3e-22 |
HORVU7Hr1G051110.3 | orthology | 0.424 | 4 | 97.4 | 5.5e-21 |
MELO3C017056.2.1 | orthology | 0.787 | 12 | 100.5 | 4.8e-22 |
Manes.05G127500.1 | orthology | 0.68 | 10 | - | - |
Manes.18G002200.1 | orthology | 0.693 | 10 | 102.8 | 1.3e-22 |
Mba08_g25790.1 | orthology | 0.379 | 4 | 121.7 | 2.6e-28 |
Oeu013567.1 | orthology | 0.652 | 8 | 104.8 | 4.6e-23 |
XP_010932092.1 | orthology | 0.32 | 5 | 132.1 | 3.1e-31 |
XP_017697769.1 | orthology | 0.345 | 5 | 131 | 6.4e-31 |
XP_019707878.1 | orthology | 0.358 | 6 | - | - |
bradi_pan_p007471 | orthology | 0.154 | 3 | 137 | 5.13e-44 |
cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.796 | 8 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.795 | 8 | 106.7 | 8.9e-24 |
cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.792 | 7 | - | - |
capan_pan_p037558 | orthology | 0.758 | 9 | 100 | 1.64e-29 |
cicar_pan_p012771 | orthology | 0.914 | 9 | 107 | 5.56e-32 |
cocnu_pan_p024788 | orthology | 0.32 | 5 | 131 | 1.09e-41 |
cocnu_pan_p029661 | orthology | 0.384 | 6 | - | - |
cucsa_pan_p017207 | orthology | 0.787 | 12 | 100 | 9.67e-30 |
maldo_pan_p020708 | orthology | 0.677 | 10 | 105 | 4.59e-31 |
medtr_pan_p031498 | orthology | 0.847 | 9 | 105 | 3.19e-31 |
musac_pan_p036492 | orthology | 0.367 | 4 | 123 | 1.44e-38 |
orysa_pan_p046260 | orthology | 0.0252 | 1 | 172 | 8.62e-58 |
phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.804 | 7 | 100.5 | 5.8e-22 |
soybn_pan_p018879 | orthology | 0.847 | 7 | 100 | 2.55e-29 |
soybn_pan_p037728 | orthology | 0.872 | 8 | - | - |
soybn_pan_p037999 | orthology | 0.913 | 8 | - | - |
soybn_pan_p041984 | orthology | 0.882 | 8 | - | - |
thecc_pan_p004256 | orthology | 0.69 | 11 | 96.3 | 6.46e-28 |
tritu_pan_p008810 | orthology | 0.16 | 4 | 130 | 2.98e-41 |
vitvi_pan_p014910 | orthology | 0.603 | 9 | 106 | 1.11e-31 |
vitvi_pan_p031077 | orthology | 0.603 | 9 | - | - |