Gene ORGLA10G0044600.1


Sequence ID ORGLA10G0044600.1  add to my list
Species Oryza glaberrima
Alias No gene alias
Length 266aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 266 amino acids

>ORGLA10G0044600.1_ORYGL
MVEELKESVKEEQAEKKEEAAEEKPDEPQEIVLKVDMHCEGCAKKVEKSLLRFEGVENVK
ADSRSKTVVVKSRAADPSKVCERVQRKTKRRVELIFPLPPPPEEEKKEEAPAPPPEEKKE
EPPKTITVILKVQMHCDACAQILQKRISRTEGVESVETDLLNGQVVVKGVMDPAVLIESI
QRKTRRPAVIVEEVKPREEEKKAEEEEKKPDEDKKADGIEEVKKYDFWPPVQYYVEYVYP
YPLPPPPTALVSEEFSDENPNACTVA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for ORGLA10G0044600.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr07989 orthology 0.774 4 150.2 1.6e-36
Mba01_g01930.1 orthology 0.615 4 133.3 2.6e-31
XP_008785647.1 orthology 0.518 3 183 4.2e-46
XP_008790335.1 orthology 0.527 3 - -
XP_010939247.1 orthology 0.524 4 181 1.7e-45
cocnu_pan_p027064 orthology 0.497 4 171 5e-54
cocnu_pan_p028794 orthology 0.549 3 - -
musac_pan_p010117 orthology 0.596 4 200 6.54e-64
orysa_pan_p012537 orthology 0.0011 1 382 4.48e-135