Gene ORGLA10G0119900.1
Sequence ID | ORGLA10G0119900.1 add to my list | ||
---|---|---|---|
Species | Oryza glaberrima | ||
Alias | No gene alias | ||
Length | 185aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 185 amino acids
>ORGLA10G0119900.1_ORYGL MADIVSDVFLSFFCCCYYPPGGHRGVGAHNDTALRRRRGGAGRSSSRPPVSLQTVELKVR MCCEGCERVVRSALANLRGVDSVEVDVAMEKVRVTGYVDRGRVLREVRRSGKKAEFWPSG GTPRRFTSEKEYFRDGEAYRGSYNYHRRGYGDGDRHGRMREPARGADAVSNMFNDDDVSA ACAIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ORGLA10G0119900.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
orysa_pan_p019824 | orthology | 0.0055 | 1 | 301 | 1.05e-105 |
tritu_pan_p003148 | orthology | 0.286 | 2 | 203 | 5.36e-67 |