Gene Oeu016262.1
Sequence ID | Oeu016262.1 add to my list | ||
---|---|---|---|
Species | Olea europaea | ||
Alias | No gene alias | ||
Length | 237aa | ||
Gene Ontology |
![]()
|
Length: 237 amino acids
>Oeu016262.1_OLEEU MQKPQVTEIQVRIDCNGCVQKIKKALQGINGIYDLNIDFAQQKIIIIGWADPERIVKAIR KTRKNAIICSQTEPPDDQPPPDGETPQPESTNPPPEADETTPAEQPKDPPPPESKPSPDE TADQPSKPKDVEEAHVINQPPPEHGGGYGGGLAYSCGGTGFRGEPPQPIYVAHSYDTYRP STYVTEYANFQPPPARYSYQGRPYHYSENFRAGNHGNGNINITSMFSDENPNACTIV
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP047778 | Unannotated cluster |
4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Oeu016262.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_17_126.8 | orthology | 0.527 | 1 | - | - |
Ca_30_103.2 | orthology | 0.527 | 3 | - | - |
Ca_5_216.1 | orthology | 0.527 | 3 | - | - |
Ca_67_634.1 | orthology | 0.517 | 1 | - | - |
Ca_71_41.4 | orthology | 0.527 | 3 | - | - |
Cc03_g01320 | orthology | 0.522 | 2 | - | - |