Gene Oeu026170.2
Sequence ID | Oeu026170.2 add to my list | ||
---|---|---|---|
Species | Olea europaea | ||
Alias | No gene alias | ||
Length | 131aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 131 amino acids
>Oeu026170.2_OLEEU MNKSLKAVKKMKGFMCHSPASTAVCMNQDYMSVIVPRNLDRKIVDRAKLINNAKYIRLGE PCKVSTTDHRRPINVSSLKKEKENGHQEVSSIAASHNVYQVVVMRVSLHCQGCAGKVKKH LSKMEGIHFPS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Oeu026170.2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_5g30890.1 | orthology | 0.655 | 3 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_22288.1 | orthology | 0.817 | 4 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_22881.1 | orthology | 0.771 | 4 | 111.3 | 5.2e-25 |
cicar_pan_p022227 | orthology | 0.862 | 3 | 89.4 | 4.5e-24 |
cocnu_pan_p025689 | orthology | 0.564 | 2 | - | - |
maldo_pan_p006499 | orthology | 0.847 | 3 | - | - |
medtr_pan_p011208 | orthology | 0.834 | 3 | 104 | 2.77e-29 |
medtr_pan_p033339 | orthology | 0.875 | 3 | - | - |
phavu.G19833.gnm2.ann1.Phvul.002G207200.1 | orthology | 0.774 | 4 | 108.2 | 4e-24 |
phavu.G19833.gnm2.ann1.Phvul.006G207900.1 | orthology | 0.942 | 4 | - | - |
soybn_pan_p021093 | orthology | 0.752 | 3 | - | - |
soybn_pan_p025312 | orthology | 0.794 | 3 | 112 | 1.42e-32 |
soybn_pan_p029731 | orthology | 0.787 | 3 | - | - |