Gene Oeu026682.1
| Sequence ID | Oeu026682.1 add to my list | ||
|---|---|---|---|
| Species | Olea europaea | ||
| Alias | No gene alias | ||
| Length | 104aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 104 amino acids
>Oeu026682.1_OLEEU MKGVTSVQVEPKQSKLTVIGYVDPEKVVARVAHRTGKKVELWPYVPYDVVEHPYAPGVYD KKAPAGYVRNAQDPRVSQLARASSTEIRYTTAFSDENPTACVVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Oeu026682.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_64_699.1 | orthology | 0.21 | 3 | - | - |
| Ca_75_432.1 | orthology | 0.19 | 3 | - | - |
| Ca_89_554.1 | orthology | 0.19 | 3 | - | - |
| Cc00_g30120 | orthology | 0.21 | 3 | - | - |
| DCAR_003170 | orthology | 0.23 | 1 | - | - |
| Oeu006689.1 | ultra-paralogy | 0.0504 | 0 | - | - |
| Oeu032526.1 | ultra-paralogy | 0.18 | 0 | - | - |
| Oeu055667.1 | ultra-paralogy | 0.31 | 0 | - | - |