Gene Oeu026926.1


Sequence ID Oeu026926.1  add to my list
Species Olea europaea
Alias No gene alias
Length 148aa



Length: 148 amino acids

>Oeu026926.1_OLEEU
MDGMRRILMEVLTEPQRGGESVLGTIKIAVLPIAKVFTMCFLGFLMASKYVNILPANGRK
LLNGLVFSLLLPCLIFSQLGQAITFEKMLQWWFIPFNVVLATISGSIIGLIVALIVHPPY
PFFKFTIIHIGIASQIAARMPLDLLPAI




Clustering Level Family ID Family Name
1
Auxin efflux carrier family
GP000355		 Auxin efflux carrier family
2 GP015273 Unannotated cluster
3 GP040583 Unannotated cluster
4 GP132349 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Membrane transport protein
IPR004776 		Membrane transport protein Family
Protein PIN-LIKES 2/6
IPR039305 		Protein PIN-LIKES 2/6 Family

IPR004776 IPR039305
Figure 1: IPR domains for Oeu026926.1