Gene Oeu028327.1


Sequence ID Oeu028327.1  add to my list
Species Olea europaea
Alias No gene alias
Length 159aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 159 amino acids

>Oeu028327.1_OLEEU
MDCNGCMQKIKKALHGINGIYDLHIDFPQQKITIIGWADPHKIAKAIKKTGKTAIICSHS
EPSDDPPSEPAPPGTEGGNQPAAEEAPPQPSLPVPENPPSEAANSTPTNQPPVQTSKPKD
AEEIHVIHHHVQDRYGPFGYGGSPAPGLISVQPPQPMFE




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP047778 Unannotated cluster
4 GP077656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Oeu028327.1