GreenPhyl v5 - Gene Oeu028401.1

Gene Oeu028401.1

Sequence ID

Oeu028401.1 ^{add to my list}

Species

Olea europaea

Alias

No gene alias

Length

152aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Homolog Predictions

152 amino acids

>Oeu028401.1_OLEEU
MGVSGTLEYLSDLMSSGYKHKRRKQLQTVNLKVRMDCDGCELKVKKAMSSLSGVKSVEID
RKQQKVTVTGYVEQSKVLKKAKSTGKKAEIWPYVPYNLVAQPYAIQAYDKKAPPGFVRKV
DNPTTGNGTLTRFEDPYITMFSDDNPNACSIM

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP040065	Unannotated cluster
4	GP463617	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for Oeu028401.1

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
Oeu045782.1	ultra-paralogy	0.0814	0	-	-
cajca.ICPL87119.gnm1.ann1.C.cajan_19470.1	orthology	0.394	2	-	-
cajca.ICPL87119.gnm1.ann1.C.cajan_32091.1	orthology	0.243	3	255.8	2e-68
cicar_pan_p004050	orthology	0.306	2	-	-
medtr_pan_p010744	orthology	0.321	2	-	-
phavu.G19833.gnm2.ann1.Phvul.001G250300.1	orthology	0.377	3	-	-
phavu.G19833.gnm2.ann1.Phvul.002G262500.1	orthology	0.26	2	248.8	2.2e-66
soybn_pan_p020347	orthology	0.402	3	-	-
soybn_pan_p028650	orthology	0.428	3	-	-
soybn_pan_p035006	orthology	0.273	3	239	2.07e-82