GreenPhyl v5 - Gene Oeu030808.1

Gene Oeu030808.1

Sequence ID

Oeu030808.1 ^{add to my list}

Species

Olea europaea

Alias

No gene alias

Length

147aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Homolog Predictions

147 amino acids

>Oeu030808.1_OLEEU
MGALDYLSNFCTVTSTGRRKRKPLQTVEIKVKMDCDGCERRVKNAVKNMKGVTNVEVRRK
QHRVTVSGYVDPNKVLKRVKSTGKRAEFWPYIPYNLVQYPYVSQAYDKRAPSGFVRNVAQ
AVPVPNASDETITYLFSDDNPNACHIM

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP040065	Unannotated cluster
4	GP463678	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for Oeu030808.1

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
Ca_1_37.3	orthology	0.234	5	255	7.8e-68
Ca_25_217.3	orthology	0.234	5	-	-
Ca_53_45.6	orthology	0.234	5	-	-
Ca_74_24.3	orthology	0.234	5	-	-
Cc07_g08240	orthology	0.234	5	255	2.6e-68
DCAR_025878	orthology	0.232	4	255.4	2.5e-68
HanXRQChr12g0375901	orthology	0.233	2	-	-
HanXRQChr17g0543461	orthology	0.216	2	256.1	2.1e-68
Oeu041969.1	ultra-paralogy	0.0635	0	-	-
PGSC0003DMP400053293	orthology	0.28	3	240.4	7.9e-64
Solyc02g091300.2.1	orthology	0.26	3	244.6	4.1e-65
capan_pan_p020935	orthology	0.255	2	244	1.17e-84