Gene Oeu042935.1


Sequence ID Oeu042935.1  add to my list
Species Olea europaea
Alias No gene alias
Length 146aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 146 amino acids

>Oeu042935.1_OLEEU
MRVHMDCAGCENKIKKALQKVKGVDDIDIDMGMQKVTVTGYADQKKVLRTVRKTGRRAEV
WQFPYIPELRNSNYAGNYNYQQHYGGPSTYYASQPSSSCYNYYKHGYNNHNYVPSYGGGS
QGHSTVFGNRTGDTFSDENPHGCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Oeu042935.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cc05_g08310 orthology 0.529 2 178.7 2.4e-45
PGSC0003DMP400035470 orthology 0.554 4 135.6 2.7e-32
Solyc07g055010.2.1 orthology 0.565 4 186.4 1.3e-47
capan_pan_p019104 orthology 0.558 3 191 8.59e-64
ipotf_pan_p020842 orthology 0.464 3 191 1.54e-63
itb02g08570.t1 orthology 0.47 3 189.9 1.3e-48