Gene Oeu043106.1


Sequence ID Oeu043106.1  add to my list
Species Olea europaea
Alias No gene alias
Length 153aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 153 amino acids

>Oeu043106.1_OLEEU
MLLYIKVWLFMQIVEMRVHMDCLGCKNNIEKALKKLNGVDNVDIDMYMQKVTVTGSVEQK
KVLKTARKTGRTVELWPYPYNPEYHGYAQSYYNQYYTTSYYSNSKAPSTYNYRKHGYNGH
SHGYYQQPPSSTVFDERTSSMFSDDNATGCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Oeu043106.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_23_1086.1 orthology 0.513 2 - -
Ca_24_186.3 orthology 0.524 3 - -
Ca_42_221.2 orthology 0.524 4 165.6 6.5e-41
Ca_66_295.2 orthology 0.524 4 - -
Cc02_g14880 orthology 0.502 3 146.7 1e-35
PGSC0003DMP400018109 orthology 0.538 4 104.4 7e-23
Solyc02g076880.2.1 orthology 0.56 4 177.6 6.5e-45
capan_pan_p000797 orthology 0.546 3 184 8.75e-61
ipotf_pan_p011098 orthology 0.472 3 120 2.65e-36
itb10g02670.t1 orthology 0.446 3 137.9 6.2e-33