Gene Oeu061138.1
Sequence ID | Oeu061138.1 add to my list | ||
---|---|---|---|
Species | Olea europaea | ||
Alias | No gene alias | ||
Length | 267aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 267 amino acids
>Oeu061138.1_OLEEU MHCEACARKVRRCLKGFEGVEDVITDCKTSKVVVKGEKADPLKVLARVQRKSHRQVELIS PIPPPPPPPPPAEEPKKEEKEVVKEEKKEEPPKITVVLKVYMHCEACSQEIRKRIQRMKG VESAEPDLKSSQVTVKGVFEPESLVNHVNKRTGKHAVIMKVEVEKKEKSKEGKKPEGGKK EVEKGEEGGKEKEEAAADGGSATEPPPTKPEAELEEDSKMDVKKNEFYYYQPHPNFHVYP DQMFVQDLYEHPPQMFSDENPNACFVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Oeu061138.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HanXRQChr12g0362781 | orthology | 1 | 2 | - | - |
HanXRQChr12g0362811 | orthology | 1 | 2 | - | - |
Oeu023492.2 | ultra-paralogy | 0.34 | 0 | - | - |
Oeu035900.1 | ultra-paralogy | 0.301 | 0 | - | - |
capan_pan_p022048 | orthology | 1 | 4 | - | - |
capan_pan_p031268 | orthology | 1 | 4 | - | - |
evm_27.model.AmTr_v1.0_scaffold00474.1 | orthology | 0.514 | 3 | - | - |
vitvi_pan_p038581 | orthology | 1 | 4 | - | - |